Invitrogen™ Human CSDC2 (aa 23-125) Control Fragment Recombinant Protein

Product Code. 30194613

Brand: Invitrogen™ RP91521

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51815 (PA5-51815. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding factor which binds specifically to the very 3'-UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Spezifikation

• Accession Number: Q9Y534
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27254
• Name: Human CSDC2 (aa 23-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI415250; AI481750; cold shock domain containing C2; cold shock domain containing C2, RNA binding; cold shock domain-containing protein C2; CSDC2; dJ347H13.2; PIPPIN; RNA-binding protein pippin
• Common Name: CSDC2
• Gene Symbol: CSDC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining