Invitrogen™ Human CSAD (aa 188-238) Control Fragment Recombinant Protein

Product Code. 30194492

Brand: Invitrogen™ RP109834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145208 (PA5-145208. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the group 2 decarboxylase family. A similar protein in rodents plays a role in multiple biological processes as the rate-limiting enzyme in taurine biosynthesis, catalyzing the decarboxylation of cysteinesulfinate to hypotaurine. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q9Y600
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51380
• Name: Human CSAD (aa 188-238) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Aspartate 1-decarboxylase; CSAD; Csd; cysteine sulfinic acid decarboxylase; cysteine sulfinic acid decarboxylase-related protein; cysteine-sulfinate decarboxylase; PCAP; P-selectin cytoplasmic tail-associated protein; sulfinoalanine decarboxylase
• Common Name: CSAD
• Gene Symbol: Csad
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining