Invitrogen™ Human CRYM (aa 237-314) Control Fragment Recombinant Protein

Product Code. 30213280

Brand: Invitrogen™ RP92503

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53920 (PA5-53920. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: Q14894
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1428
• Name: Human CRYM (aa 237-314) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CDK108; Crym; crystallin mu; crystallin, mu; DFNA40; ketimine reductase mu-crystallin; mu-crystallin homolog; Mu-crystallin-like protein; NADP-regulated thyroid-hormone binding protein; NADP-regulated thyroid-hormone-binding protein; similar to Mu-crystallin homolog (NADP-regulated thyroid-hormone binding protein); THBP; thiomorpholine-carboxylate dehydrogenase
• Common Name: CRYM
• Gene Symbol: CRYM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining