Invitrogen™ Human CRYAB (aa 121-172) Control Fragment Recombinant Protein

Product Code. 30206794

Brand: Invitrogen™ RP104094

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111446 (PA5-111446. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lens proteins consist almost entirely of crystallins (about 95%). Crystallins are also found vertebrate skeletal muscle tissue. In the lens, their structural function is to assist in maintaining the proper refractive index of the lens. The mammalian lens contains 3 major classes of crystallins: alpha, beta, and gamma. Alpha-crystallin is the largest of the crystallins and is composed of 2 primary gene products-alpha-A and alpha-B. There are at least 5 different proteins comprising the beta-crystallins. The gamma-crystallins are monomeric, but there are at least 5 gamma crystallins identified in bovine and rat lens. Alpha-Crystallin comprises 40% of total lens protein composition. In addition to maintaining proper refractive index, it also functions in a chaperone like manner by preventing the formation of aggregates possibly leading to cataract formation. It is believed that the phosphorylated states of the alpha-crystallin occur in response to cellular stress and may serve a structural control function and play a role in protein maintenance. Alpha-B crystallin has been linked to Alexander's disease where it accumulates in brain cells of those afflicted.

Specifications

• Accession Number: P02511
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1410
• Name: Human CRYAB (aa 121-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310001E10Rik; 3526402H21Rik; AACRYA; active transcription factor CREB; alpha B-crystallin; alpha crystallin B; alpha(B)-crystallin; alpha-B-crystallin; Alpha-crystallin B chain; alpha-crystallin B chain-like protein; AV083133; cAMP response element binding protein 1; cAMP responsive element binding protein 1; cAMP-response element-binding protein-1; cAMP-responsive element-binding protein 1; CMD1II; CREB; CREB1; CREB-1; Crya2; Crya-2; CRYAB; CryAB antibody; crystallin alpha B; crystallin, alpha 2; crystallin, alpha B; crystallin, alpha polypeptide 2; CTPP2; CTRCT16; cyclic adenosine 3',5'-monophosphate response element-binding protein CREB; cyclic AMP-responsive element-binding protein 1; epididymis secretory protein Li 101; heat shock protein beta-5; heat shock protein CryAB; heat shock protein HspB5; heat-shock 20 kD like-protein; HEL-S-101; HSPB5; HspB5 protein; MFM2; P23; Renal carcinoma antigen NY-REN-27; rosenthal fiber component; transactivator protein; Y protein
• Common Name: CRYAB
• Gene Symbol: Cryab
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining