Invitrogen™ Human CRTC3 (aa 92-158) Control Fragment Recombinant Protein

Product Code. 30204684

Brand: Invitrogen™ RP100404

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83679 (PA5-83679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene has similarity to a yeast protein. It seems to be part of a peripheral membrane protein complex localized on cis/medial Golgi cisternae where it may participate in tethering intra-Golgi transport vesicles.

Specifications

• Accession Number: Q6UUV7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64784
• Name: Human CRTC3 (aa 92-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610312F20Rik; 6332415K15Rik; AI429792; BC011210; CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; Crtc3; RGD1309666; TORC3; TORC-3; transducer of CREB protein 3; transducer of regulated cAMP response element-binding protein (CREB) 3; transducer of regulated cAMP response element-binding protein 3; transducer of regulated CREB protein 3
• Common Name: CRTC3
• Gene Symbol: Crtc3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining