Invitrogen™ Human CRTAP (aa 335-400) Control Fragment Recombinant Protein

Product Code. 30180869

Brand: Invitrogen™ RP99891

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60630 (PA5-60630. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass.

Specifications

• Accession Number: O75718
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10491
• Name: Human CRTAP (aa 335-400) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730529N23Rik; cartilage associated protein; cartilage-associated protein; cartilage-associated-like protein; CASP; CRTAP; leprecan-like 3; LEPREL3; OI7; P3h5; prolyl 3-hydroxylase family member 5 (non-enzymatic); RGD1565180; wu:fb47h01; zgc:85621
• Common Name: CRTAP
• Gene Symbol: CRTAP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEET
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining