Invitrogen™ Human CRSP130 (aa 245-324) Control Fragment Recombinant Protein

Product Code. 30195377

Brand: Invitrogen™ RP105501

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84839 (PA5-84839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRSP is ubiquitously expressed in various tissues and functions as a multimeric complex that consists of nine distinct subunits. Several members of the CRSP family share sequence similarity with multiple components of the yeast transcriptional mediator proteins, including CRSP150, which is related to yeast Rgr1, and CRSP70, which is similar to the elongation factor TFIIS. CRSP77 and CRSP150 are also related to proteins within the putative murine mediator complex, while CRSP130 and CRSP34 are largely unrelated to either murine or yeast proteins. CRSP subunits also associate with larger multimeric co-activator complexes, including ARC/DRI, which binds directly to SREBP and nuclear hormone receptors to facilitate transcription, and with NAT, a polymerase II-interacting complex that represses activated transcription.

Specifications

• Accession Number: Q9ULK4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9439
• Name: Human CRSP130 (aa 245-324) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 130 kDa transcriptional co-activator; 130 kDa; 133 kDa transcriptional co-activator; 3000002A17Rik; activator-recruited cofactor 130 kDa component; ARC130; Cofactor required for Sp1 transcriptional activation subunit 3; cofactor required for Sp1 transcriptional activation, subunit 3 (130 kD); CRSP complex subunit 3; CRSP130; CRSP133; Crsp3; DRIP130; ESTM7; hSur-2; KIAA1216; Med23; Mediator complex subunit 23; mediator complex subunit MED23 variant MED23_i6; mediator complex subunit MED23 variant MED23_i7; mediator of RNA polymerase II transcription subunit 23; mKIAA1216; MRT18; mSur-2; Protein sur-2 homolog; SUR2; SUR-2; Transcriptional coactivator CRSP130; vitamin D3 receptor interacting protein; Vitamin D3 receptor-interacting protein complex 130 kDa component; X83317
• Common Name: CRSP130
• Gene Symbol: MED23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining