Invitrogen™ Human CRMP5 (aa 241-326) Control Fragment Recombinant Protein

Product Code. 30211958

Brand: Invitrogen™ RP105561

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84896 (PA5-84896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked to paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus.

Specifications

• Accession Number: Q9BPU6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56896
• Name: Human CRMP5 (aa 241-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: collapsin response mediator protein 5; collapsin response mediator protein-5; CRAM; CRMP3-associated molecule; Crmp5; CRMP-5; dihydropyrimidinase like 5; dihydropyrimidinase-like 5; dihydropyrimidinase-related protein 5; Dpysl5; DRP-5; Ulip6; ULIP-6; ULIP6 protein; UNC33-like phosphoprotein 6
• Common Name: CRMP5
• Gene Symbol: DPYSL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining