missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204579

Invitrogen™ Human CRMP2 (aa 88-227) Control Fragment Recombinant Protein

Product Code. 30204579
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204579

Brand: Invitrogen™ RP101859

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16555
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1808
Name Human CRMP2 (aa 88-227) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI851130; collapsin response mediator protein 2; collapsin response mediator protein hCRMP-2; CRMP2; CRMP-2; DHPRP2; dihydropyrimidinase like 2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; DPYL2; Dpysl2; DRP2; DRP-2; Musunc33; N2A3; Neural-specific protein NSP60; TOAD-64; turned on after division 64; turned on after division 64 kDa protein; turned on after division, 64 kDa protein; ULIP2; ULIP-2; unc-33-like phosphoprotein 2; Unknown (protein for MGC:137406)
Common Name CRMP2
Gene Symbol DPYSL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.