Invitrogen™ Human CRM1 (aa 935-1071) Control Fragment Recombinant Protein

Product Code. 30209355

Brand: Invitrogen™ RP91836

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Exportin - 1 (XPO1) mediates the nuclear export of cellular proteins bearing a leucine-rich nuclear export signal (NES) and RNAs. In the nucleus, in association with RANBP3, XPO1 binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex is mediated through binding to nucleoproteins. Upon transit of a nuclear complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP cause release of the cargo from the export receptor. The directionality of the nuclear export is thought to be conferred by an asymmetric distribution of the GTP and GDP bound forms of Ran between the cytoplasm and nucleus.

Specifications

• Accession Number: O14980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7514
• Name: Human CRM1 (aa 935-1071) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA420417; chromosome region maintenance 1 homolog; chromosome region maintenance 1 protein homolog; CRM1; emb; Exp1; exportin 1; exportin 1 (CRM1 homolog, yeast); exportin 1 (CRM1, yeast, homolog); exportin 1, CRM1 homolog; exportin 1, CRM1 homolog (yeast); exportin-1; exportin-1 (required for chromosome region maintenance); Xpo1
• Common Name: CRM1
• Gene Symbol: XPO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining