Invitrogen™ Human CRISP3 (aa 193-243) Control Fragment Recombinant Protein

Product Code. 30203526

Brand: Invitrogen™ RP100095

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84197 (PA5-84197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cysteine-rich secretory protein 3 (CRISP-3; also known as SGP28) is a glycoprotein that belongs to the family of cysteine-rich secretory proteins (CRISPs) which was originally discovered in human neutrophilic granulocytes. CRISP-3 is also widely distibuted in exocrine glands (salivary glands, pancreas and prostate), eosinophilic granulocytes and to a lower level in epididymis, ovary, thymus and colon. The presence of CRISP-3 in neutrophils, eosinophils and in exocrine secretions indicates a role in innate host defense. The antibody has been raised against recombinant C-terminally truncated form of CRISP-3 and recognizes both the N-glycosylated and non-glycosylated form of the mature protein.

Specifications

• Accession Number: P54108
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10321
• Name: Human CRISP3 (aa 193-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 32 kDa epididymal protein; Acidic epididymal glycoprotein; Acidic epididymal glycoprotein 2; acidic epididymal glycoprotein D/E; Aeg; Aeg2; Aeg-2; Crisp1; Crisp-1; Crisp3; CRISP-3; CRISP-3 mgC126588; CRS3; cysteine rich secretory protein 3; cysteine-rich secretory protein 1; Cysteine-rich secretory protein 3; cysteine-rich secretory protein-3; dJ442L6.3; epididymal glycoprotein; protein D; protein E; protein IV; SCP; SCP 2; SGP28; Sialoprotein; specific granule protein (28 kDa); specific granule protein of 28 kDa; Sperm-coating glycoprotein; sperm-coating glycoprotein 2
• Common Name: CRISP3
• Gene Symbol: Crisp3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining