missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CRISP3 (aa 193-243) Control Fragment Recombinant Protein

Product Code. 30203526
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203526

Brand: Invitrogen™ RP100095

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84197 (PA5-84197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cysteine-rich secretory protein 3 (CRISP-3; also known as SGP28) is a glycoprotein that belongs to the family of cysteine-rich secretory proteins (CRISPs) which was originally discovered in human neutrophilic granulocytes. CRISP-3 is also widely distibuted in exocrine glands (salivary glands, pancreas and prostate), eosinophilic granulocytes and to a lower level in epididymis, ovary, thymus and colon. The presence of CRISP-3 in neutrophils, eosinophils and in exocrine secretions indicates a role in innate host defense. The antibody has been raised against recombinant C-terminally truncated form of CRISP-3 and recognizes both the N-glycosylated and non-glycosylated form of the mature protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P54108
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10321
Name Human CRISP3 (aa 193-243) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 32 kDa epididymal protein; Acidic epididymal glycoprotein; Acidic epididymal glycoprotein 2; acidic epididymal glycoprotein D/E; Aeg; Aeg2; Aeg-2; Crisp1; Crisp-1; Crisp3; CRISP-3; CRISP-3 mgC126588; CRS3; cysteine rich secretory protein 3; cysteine-rich secretory protein 1; Cysteine-rich secretory protein 3; cysteine-rich secretory protein-3; dJ442L6.3; epididymal glycoprotein; protein D; protein E; protein IV; SCP; SCP 2; SGP28; Sialoprotein; specific granule protein (28 kDa); specific granule protein of 28 kDa; Sperm-coating glycoprotein; sperm-coating glycoprotein 2
Common Name CRISP3
Gene Symbol Crisp3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.