Invitrogen™ Human CRG-L2 (aa 79-140) Control Fragment Recombinant Protein

Product Code. 30208276

Brand: Invitrogen™ RP103354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63723 (PA5-63723. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRG-L2 is a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in this gene cause a form of lethal congenital contracture syndrome in human patients. Autoantibodies to the encoded protein have been identified in sera form patients with multifocal motor neuropathy.

Specifications

• Accession Number: Q6ZMI3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342035
• Name: Human CRG-L2 (aa 79-140) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cancer related gene - liver 2; cancer-related gene liver 2 protein; Clom; collomin; COLM; colmedin; Crgl2; CRG-L2; Crlg2; FLJ23917; Gldn; Gliomedin; Gliomedin shedded ectodomain; olfactomedin-related protein; UNC-112; UNQ9339/PRO34011
• Common Name: CRG-L2
• Gene Symbol: Gldn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining