Invitrogen™ Human CRELD1 (aa 350-412) Control Fragment Recombinant Protein

Product Code. 30199611

Brand: Invitrogen™ RP91008

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55468 (PA5-55468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Specifications

• Accession Number: Q96HD1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 78987
• Name: Human CRELD1 (aa 350-412) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI843811; AVSD2; CIRRIN; CRELD1; cysteine rich with EGF like domains 1; cysteine rich with EGF-like domains 1; cysteine-rich with EGF-like domain protein 1; cysteine-rich with EGF-like domains 1; DKFZP566D213; i11E7 protein; protein disulfide isomerase CRELD1; UNQ188/PRO214
• Common Name: CRELD1
• Gene Symbol: Creld1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining