Invitrogen™ Human CREB3L3 (aa 125-214) Control Fragment Recombinant Protein

Product Code. 30180490

Brand: Invitrogen™ RP98334

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59244 (PA5-59244. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CREB3L3 is a liver-specific transcription factor and member of the CREB/ATF transcription factor family (Omori et al., 2001 [PubMed 11353085]).

Specifications

• Accession Number: Q68CJ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84699
• Name: Human CREB3L3 (aa 125-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC010786; cAMP responsive element binding protein 3 like 3; cAMP responsive element binding protein 3-like 3; cAMP-responsive element-binding protein 3-like protein 3; CREB/ATF family transcription factor; CREB3L3; CREBH; CREB-H; Cyclic AMP-responsive element-binding protein 3-like protein 3; D10Bur1e; HYST1481; Processed cyclic AMP-responsive element-binding protein 3-like protein 3; Transcription factor CREB-H
• Common Name: CREB3L3
• Gene Symbol: CREB3L3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining