Invitrogen™ Human CREB (aa 89-189) Control Fragment Recombinant Protein

Product Code. 30204084

Brand: Invitrogen™ RP102156

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CREB (Cyclic AMP response element binding protein) is a 43 kDa basic/leucine zipper transcription factor that binds the cyclic AMP response element (CRE) and activates transcription in response to a variety of extracellular signals including neurotransmitters, hormones, membrane depolarization, and growth and neurotrophic factors. Activation of CREB is dependent upon the phosphorylation of serine 133. Phosphorylation of CREB occurs via p44/42 MAP kinase and p90RSK, and via p38 MAP kinase and MSK1. Although CREB will bind DNA independent of its phosphorylation state, only the phosphorylated form is competent as a transcription factor. CREB binding protein (CBP), a transcriptional coactivator that directly interacts with CREB, binds to CREB in the region of serine 133. CREB is involved in different cellular processes including the synchronization of circadian rhythmicity, differentiation of adipose cells, and learning and memory. In humans, the gene is located on the q arm of chromosome 2. Diseases associated with CREB dysfunction include Alzheimer’s Disease, histiocytoma and soft tissue melanoma.

Specifications

• Accession Number: P16220
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1385
• Name: Human CREB (aa 89-189) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310001E10Rik; 3526402H21Rik; active transcription factor CREB; AV083133; cAMP response element binding protein 1; cAMP responsive element binding protein 1; cAMP-response element-binding protein-1; cAMP-responsive element-binding protein 1; CREB; CREB1; Creb-1; cyclic adenosine 3',5'-monophosphate response element-binding protein CREB; cyclic AMP-responsive element-binding protein 1; htCREB; MGC9284; OTTHUMP00000206661; OTTHUMP00000206662; OTTHUMP00000206667; transactivator protein; Y protein
• Common Name: CREB
• Gene Symbol: CREB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining