Invitrogen™ Human CPT1B (aa 178-228) Control Fragment Recombinant Protein

Product Code. 30208857

Brand: Invitrogen™ RP109696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

Specifications

• Accession Number: Q92523
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1375
• Name: Human CPT1B (aa 178-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: carnitine O-palmitoyltransferase 1, muscle isoform; carnitine O-palmitoyltransferase 1, muscle isoform; synaptonemal complex central element protein 3; carnitine O-palmitoyltransferase 1 B; carnitine O-palmitoyltransferase I, mitochondrial muscle isoform; carnitine O-palmitoyltransferase I, muscle isoform; Carnitine palmitoyltransferase 1 beta, muscle isoform; Carnitine palmitoyltransferase 1, muscle; carnitine palmitoyltransferase 1 A like; carnitine palmitoyltransferase 1 B; carnitine palmitoyltransferase 1 B (muscle); carnitine palmitoyltransferase 1 B isoform a; carnitine palmitoyltransferase 1 b, muscle; carnitine palmitoyltransferase I; carnitine palmitoyltransferase Ibeta 1; carnitine palmitoyltransferase Ibeta 2; carnitine palmitoyltransferase Ibeta 3; carnitine palmitoyltransferase I-like protein; CPT I; Cpt1; cpt1al; CPT1B; CPT1M; Cpt1-m; CPTI; CPTIB; CPT-IB; CPT-Ibeta 1; CPT-Ibeta 3; CPTI-M; EC 2.3.1.21; FLJ55729; FLJ58750; hypothetical protein LOC449677; KIAA1670; LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, muscle isoform; MCCPT1; MCPT1; M-CPT1; M-cpti; muscle-type carnitine palmitoyltransferase I; zgc:103709
• Common Name: CPT1B
• Gene Symbol: CPT1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining