Invitrogen™ Human CPSF7 (aa 42-120) Control Fragment Recombinant Protein

Product Code. 30193813

Brand: Invitrogen™ RP97388

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59423 (PA5-59423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLJ12529 is a protein coding gene.

Specifications

• Accession Number: Q8N684
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79869
• Name: Human CPSF7 (aa 42-120) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730453I16Rik; AL022757; C330017N18Rik; CFIm59; cleavage and polyadenylation specific factor 7; cleavage and polyadenylation specific factor 7, 59 kDa; cleavage and polyadenylation specificity factor 59 kDa subunit; Cleavage and polyadenylation specificity factor subunit 7; cleavage factor Im complex 59 kDa subunit; CPSF 59 kDa subunit; Cpsf7; FLJ12529; LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 7; pre mRNA cleavage factor I, 59 kDa subunit; pre-mRNA cleavage factor I, 59 kDa subunit; pre-mRNA cleavage factor Im 59 kDa subunit; RGD1305441; Unknown (protein for IMAGE:7949905)
• Common Name: CPSF7
• Gene Symbol: CPSF7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining