Invitrogen™ Human CPSF4 (aa 160-216) Control Fragment Recombinant Protein

Product Code. 30210316

Brand: Invitrogen™ RP107497

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111614 (PA5-111614. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene.

Specifications

• Accession Number: O95639
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10898
• Name: Human CPSF4 (aa 160-216) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 30 kDa; C79664; cleavage and polyadenylation specific factor 4; cleavage and polyadenylation specific factor 4, 30 kD subunit; cleavage and polyadenylation specific factor 4, 30 kDa; cleavage and polyadenylation specificity factor 30 kDa subunit; Cleavage and polyadenylation specificity factor subunit 4; clipper homolog; Clipper/CPSF 30 K; CPSF 30 kDa subunit; Cpsf30; CPSF4; musculus clipper/cleavage and polyadenylation specificity factor 30 kDa subunit; NAR; NEB1; NEB-1; no; no arches homolog; no arches-like zinc finger protein; NS1 effector domain-binding protein 1
• Common Name: CPSF4
• Gene Symbol: CPSF4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining