Invitrogen™ Human CPSF3 (aa 522-600) Control Fragment Recombinant Protein

Product Code. 30213232

Brand: Invitrogen™ RP96050

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57005 (PA5-57005. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Most eukaryotic mRNA precursors (pre-mRNAs) undergo extensive maturational processing, including cleavage and polyadenylation at the 3-prime end. CPSF3 encodes the 73-kD subunit of the cleavage and polyadenylation specificity factor (CPSF) and is the pre-mRNA 3-prime-end-processing endonuclease (Mandel et al., 2006).

Specifications

• Accession Number: Q9UKF6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51692
• Name: Human CPSF3 (aa 522-600) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cleavage and polyadenylation specific factor 3; cleavage and polyadenylation specific factor 3, 73 kDa; cleavage and polyadenylation specificity factor 3; cleavage and polyadenylation specificity factor 73 kDa subunit; Cleavage and polyadenylation specificity factor subunit 3; CPSF; CPSF 73 kDa subunit; Cpsf3; Cpsf73; CPSF-73; mRNA 3'-end-processing endonuclease CPSF-73; YSH1
• Common Name: CPSF3
• Gene Symbol: Cpsf3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining