Invitrogen™ Human CPS1 Control Fragment Recombinant Protein

Product Code. 30204129

Brand: Invitrogen™ RP102361

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82760 (PA5-82760. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.

Specifications

• Accession Number: P31327
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1373
• Name: Human CPS1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732433M03Rik; carbamoyl-phosphate synthase (ammonia); carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoyl-phosphate synthase 1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl-phosphate synthetase 1; carbamoyl-phosphate synthetase 1, mitochondrial; carbamoylphosphate synthetase I; carbamoyl-phosphate synthetase I; carbamyl phosphate synthetase I; carboamyl-phosphate synthetase 1; cps; CPS1; CPSase I; CPSASE1; CPSI; D1Ucla3; PHN
• Common Name: CPS1
• Gene Symbol: CPS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining