Invitrogen™ Human CPNE4 (aa 525-557) Control Fragment Recombinant Protein

Product Code. 30195074

Brand: Invitrogen™ RP108297

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85056 (PA5-85056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Specifications

• Accession Number: Q96A23
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 131034
• Name: Human CPNE4 (aa 525-557) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3632411M23Rik; 4933406O10Rik; copine 4; copine 8; copine IV; Copine-4; Copine-8; COPN4; CPN4; Cpne4
• Common Name: CPNE4
• Gene Symbol: CPNE4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining