Invitrogen™ Human CPI-17 (aa 39-91) Control Fragment Recombinant Protein

Product Code. 30200493

Brand: Invitrogen™ RP102920

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83590 (PA5-83590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CPI-17 is a phosphorylation-dependent inhibitory protein for smooth muscle myosin phosphate. CPI-17 was originally identified as a PKC-potentiated inhibitory protein of protein phosphatase-1, which is dominantly expressed in smooth muscle. Phosphorylation at Threonine 38, in vitro, by PKC or Rho-kinase enhances the inhibitory potency toward myosin phosphatase. CPI-17 is also phosphorylated at Threonine 38 by protein kinase N and might be involved in the calcium sensitization of smooth muscle contraction as a downstream effector of Rho and/or arachidonic acid. CPI-17 is dually phosphorylated at Serine 12 and Threonine 38 by a MYPT-associated kinase, M110 kinase.

Specifications

• Accession Number: Q96A00
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 94274
• Name: Human CPI-17 (aa 39-91) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110001M11Rik; 17 kDa PKC-potentiated inhibitory protein of PP1; 17-kDa PKC-potentiated inhibitory protein of PP1; 17-KDa protein; Cpi; CPI17; CPI-17; PKC-potentiated inhibitory protein of PP1; PPP1INL; PPP1R14A; Protein kinase C-potentiated inhibitor protein of 17 kDa; protein phosphatase 1 regulatory inhibitor subunit 14 A; protein phosphatase 1 regulatory subunit 14 A; protein phosphatase 1, regulatory (inhibitor) subunit 14 A
• Common Name: CPI-17
• Gene Symbol: PPP1R14A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining