Invitrogen™ Human COX7A2L (aa 3-76) Control Fragment Recombinant Protein

Codice prodotto. 30204820

Marca: Invitrogen™ RP106919

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66237 (PA5-66237. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cytochrome c oxidase (COX) family of proteins function as the final electron donor in the respiratory chain to drive a proton gradient across the inner mitochondrial membrane, ultimately resulting in the production of water. The mammalian COX apoenzyme is a dimer, with each monomer consisting of 13 subunits, some of which are mitochondrial and some of which are nuclear. COX7a2 (cytochrome c oxidase subunit VIIa polypeptide 2), also known as COX7AL or COX7AL1, is an 83 amino acid protein that localizes to the inner mitochondrial membrane and exists as a component of the COX complex, playing an important role in electron transport. COX7a2L (cytochrome c oxidase subunit 7A-related protein), also known as COX7AR or COX7RP, is an inner mitochondrial membrane protein that consists of 114 amino acids and is induced by estrogen.

Specifica

• Accession Number: O14548
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9167
• Name: Human COX7A2L (aa 3-76) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CO x 7A2L; CO x 7 AR; CO x 7 A-related protein; CO x 7 RP; cytochrome c oxidase subunit 7A2 like; cytochrome c oxidase subunit 7 A-related protein, mitochondrial; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit VIIa polypeptide 2-like; cytochrome c oxidase subunit VIIa-related protein; cytochrome c oxidase subunit VII-related protein; EB1; estrogen receptor binding CpG island; Scaf1; SIG81; SIG-81; Silg81; Silica-induced gene 81 protein; supercomplex assembly factor I
• Common Name: COX7A2L
• Gene Symbol: Cox7a2l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining