Invitrogen™ Human COX4NB (aa 4-56) Control Fragment Recombinant Protein

Product Code. 30181311

Brand: Invitrogen™ RP98556

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61984 (PA5-61984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EMC8 (ER Membrane Protein Complex Subunit 8) is a Protein Coding gene. An important paralog of this gene is EMC9.[GeneCards]

Specifications

• Accession Number: O43402
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10328
• Name: Human COX4NB (aa 4-56) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C16orf2; C16orf4; COX4 neighbor; COX4AL; COX4NB; Emc8; ER membrane protein complex subunit 8; FAM158B; family with sequence similarity 158, member B; neighbor of COX4; NOC4; Protein FAM158B
• Common Name: COX4NB
• Gene Symbol: Emc8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining