Invitrogen™ Human COX16 (aa 70-105) Control Fragment Recombinant Protein

Product Code. 30199800

Brand: Invitrogen™ RP102011

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64046 (PA5-64046. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is encoded by COX16, corresponding to the previously uncharacterized open reading frame YJL003w of the yeast genome. COX16 was identified in studies of COX-deficient mutants previously assigned to complementation group G22 of a collection of yeast pet mutants. To determine its location, Cox16p was tagged with a Myc epitope at the C terminus.

Specifications

• Accession Number: Q9P0S2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51241
• Name: Human COX16 (aa 70-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810020G14Rik; 1810055I05Rik; BB388670; C14orf112; COX16; COX16 cytochrome c oxidase assembly homolog; COX16, cytochrome c oxidase assembly homolog; cytochrome c oxidase assembly factor; cytochrome c oxidase assembly protein 16; cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; hCOX16; HSPC203; PTD019
• Common Name: COX16
• Gene Symbol: Cox16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining