Invitrogen™ Human COX11 (aa 192-274) Control Fragment Recombinant Protein

Product Code. 30199875

Brand: Invitrogen™ RP100211

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60591 (PA5-60591. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain, functioning as a transmembrane proton pump that builds an electrochemical gradient with chemical energy from the reduction of O2. Cytochrome c oxidase assembly protein COX11 is an intracellular mitochondrial membrane protein necessary for the construction of an active COX complex. COX11 contains a single transmembrane helix downstream of the N-terminal, mitochondrial targeting sequence and a C-terminal Cu(I)-binding domain. The assembly of COX requires the delivery of metal cofactors. Along with COX12 and SCO1/2, COX11 acts as a metal ion chaperone necessary for copper insertion into CuA and CuB redox-active copper centers of COX in eukaryotes.

Specifications

• Accession Number: Q9Y6N1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1353
• Name: Human COX11 (aa 192-274) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010004I09Rik; Cox11; COX11 cytochrome c oxidase copper chaperone; COX11 homolog, cytochrome c oxidase assembly protein; COX11, cytochrome c oxidase copper chaperone; COX11P; cytochrome c oxidase assembly homolog 11; cytochrome c oxidase assembly protein 11; cytochrome c oxidase assembly protein COX11, mitochondrial; cytochrome c oxidase subunit 11
• Common Name: COX11
• Gene Symbol: COX11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining