missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COX11 (aa 192-274) Control Fragment Recombinant Protein

Product Code. 30199875
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199875

Brand: Invitrogen™ RP100211

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60591 (PA5-60591. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain, functioning as a transmembrane proton pump that builds an electrochemical gradient with chemical energy from the reduction of O2. Cytochrome c oxidase assembly protein COX11 is an intracellular mitochondrial membrane protein necessary for the construction of an active COX complex. COX11 contains a single transmembrane helix downstream of the N-terminal, mitochondrial targeting sequence and a C-terminal Cu(I)-binding domain. The assembly of COX requires the delivery of metal cofactors. Along with COX12 and SCO1/2, COX11 acts as a metal ion chaperone necessary for copper insertion into CuA and CuB redox-active copper centers of COX in eukaryotes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6N1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1353
Name Human COX11 (aa 192-274) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010004I09Rik; Cox11; COX11 cytochrome c oxidase copper chaperone; COX11 homolog, cytochrome c oxidase assembly protein; COX11, cytochrome c oxidase copper chaperone; COX11P; cytochrome c oxidase assembly homolog 11; cytochrome c oxidase assembly protein 11; cytochrome c oxidase assembly protein COX11, mitochondrial; cytochrome c oxidase subunit 11
Common Name COX11
Gene Symbol COX11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.