Invitrogen™ Human Cortactin (aa 231-306) Control Fragment Recombinant Protein

Product Code. 30203441

Brand: Invitrogen™ RP103299

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cortactin (Cttn) is a ubiquitous actin-binding protein that was originally identified as a substrate for Src. It contributes to the organization of the actin cytoskeleton and cell shape. Cortactin also plays a role in the formation of lamellipodia and cell migration. It is accumulated in peripheral, actin-enriched structures of cells suggesting that cortactin facilitates actin network formation. Cortactin has four major domains of interest the N-terminal acidic (NTA) and tandem repeats domains and the C-terminal proline-rich and SH3 Domains. NTA associates with the Arp2/3 and WASP complex at F-actin branches. Cortactin is involved in promoting cell motility and invasion, including a critical role in invadopodia, actin rich-subcellular protrusions associated with degradation of the ECM by cancer cells. Cortactin is phosphorylated by src family kinases at Y421, Y466, and Y482 and S405 and S418 that are phosphorylated by Erk family kinases.

Specifications

• Accession Number: Q14247
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2017
• Name: Human Cortactin (aa 231-306) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110020L01Rik; amplaxin; cortactin; Cttn; Cttnb; EMS1; ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate); FLJ34459; mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); oncogene EMS1; Oncogene SRC8; Src substrate cortactin; src8; Unknown (protein for MGC:137923)
• Common Name: Cortactin
• Gene Symbol: Cttn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining