Invitrogen™ Human Coronin 7 (aa 3-94) Control Fragment Recombinant Protein

Product Code. 30181369

Brand: Invitrogen™ RP98664

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62813 (PA5-62813. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coronins, such as CORO7, constitute an evolutionarily conserved family of WD-repeat actin-binding proteins. CORO7 plays a role in Golgi complex morphology and function (Rybakin et al., 2004, 2006 [PubMed 15327992] [PubMed 16905771]).

Specifications

• Accession Number: P57737
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79585
• Name: Human Coronin 7 (aa 3-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610011B16Rik; 70 kDa WD repeat tumor rejection antigen; 70 kDa WD repeat tumor rejection antigen homolog; AW048373; AW556392; CORO7; coronin 7; coronin-7; CRN7; POD1; tumor specific antigen 70 kDa
• Common Name: Coronin 7
• Gene Symbol: CORO7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFRVSKFRHTEARPPRRESWISDIRAGTAPSCRNHIKSSCSLIAFNSDRPGVLGIVPLQGQGEDKRRVAHLGCHSDLVTDLDFSPFDDFLLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining