Invitrogen™ Human Coronin 3 (aa 386-472) Control Fragment Recombinant Protein

Product Code. 30181252

Brand: Invitrogen™ RP97664

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111141 (PA5-111141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coronin 3 is associated with the aggression and metastasis of hepatocellular carcinoma. Coronins are a family of highly evolutionary conserved proteins reportedly involved in the regulation of actin cytoskeletal dynamics, although only coronin 3 has been shown to be related to cancer cell migration.

Specifications

• Accession Number: Q9ULV4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23603
• Name: Human Coronin 3 (aa 386-472) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL022675; AW455561; AW548837; Coro1c; coronin 1 c; coronin 3; coronin, actin binding protein 1 C; coronin, actin binding protein, 1 C; coronin, actin-binding protein, 1 C; coronin-1 C; Coronin-3; CRN2; CRNN4; hCRNN4; RGD1564490
• Common Name: Coronin 3
• Gene Symbol: Coro1c
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining