Invitrogen™ Human Coronin 2A (aa 367-439) Control Fragment Recombinant Protein

Product Code. 30181491

Brand: Invitrogen™ RP98381

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59458 (PA5-59458. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants.

Spezifikation

• Accession Number: Q92828
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7464
• Name: Human Coronin 2 A (aa 367-439) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLIPINB; CORO2A; coronin 2 A; coronin, actin binding protein, 2 A; coronin, actin-binding protein, 2 A; coronin-2 A; coronin-like protein B; IR10; WD protein IR10; WD repeat-containing protein 2; WDR2; WD-repeat protein 2
• Common Name: Coronin 2 A
• Gene Symbol: CORO2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining