Invitrogen™ Human COQ9 (aa 233-311) Control Fragment Recombinant Protein

Product Code. 30181043

Brand: Invitrogen™ RP98624

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59352 (PA5-59352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coenzyme Q10 (CoQ10), or ubiquinone, is a mobile lipophilic electron carrier critical for electron transfer by the mitochondrial inner membrane respiratory chain. COQ9 is 1 of several enzymes involved in biosynthesis of CoQ10 and likely functions in modification of the benzoquinone ring.

Specifications

• Accession Number: O75208
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57017
• Name: Human COQ9 (aa 233-311) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310005O14Rik; C16orf49; C78387; coenzyme Q9; coenzyme Q9 homolog; coenzyme Q9 homolog (yeast); COQ10D5; COQ9; HSPC326; PSEC0129; Ubiquinone biosynthesis protein COQ9, mitochondrial
• Common Name: COQ9
• Gene Symbol: COQ9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining