missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COQ3 (aa 106-177) Control Fragment Recombinant Protein

Product Code. 30211862
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211862 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211862 Supplier Invitrogen™ Supplier No. RP94829

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56698 (PA5-56698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes. This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51805
Name Human COQ3 (aa 106-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2-polyprenyl-6-hydroxyphenol methylase; 2-polyprenyl-6-hydroxyphenyl methylase; 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; 3-demethylubiquinol 3-O-methyltransferase; 3-demethylubiquinone-10 3-methyltransferase; 3-demethylubiquinone-9 3-methyltransferase; 4732433J24; bA9819.1; C77934; Coenzyme Q (ubiquinone); coenzyme Q3 homolog methyltransferase; coenzyme Q3 homolog, methyltransferase; coenzyme Q3 homolog, methyltransferase (yeast); coenzyme Q3 methyltransferase; coenzyme Q3, methyltransferase; Coq3; DHHB methyltransferase; DHHBMT; DHHB-MT; DHHBMTASE; DHHB-MTase; dihydroxyhexaprenylbenzoate methyltransferase; hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; methyltransferase COQ3; polyprenyldihydroxybenzoate methyltransferase; Ubiquinone biosynthesis O-methyltransferase, mitochondrial; UG0215E05
Common Name COQ3
Gene Symbol COQ3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.