Invitrogen™ Human COQ3 (aa 106-177) Control Fragment Recombinant Protein

Product Code. 30211862

Brand: Invitrogen™ RP94829

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56698 (PA5-56698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes. This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.

Specifications

• Accession Number: Q9NZJ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51805
• Name: Human COQ3 (aa 106-177) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-polyprenyl-6-hydroxyphenol methylase; 2-polyprenyl-6-hydroxyphenyl methylase; 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; 3-demethylubiquinol 3-O-methyltransferase; 3-demethylubiquinone-10 3-methyltransferase; 3-demethylubiquinone-9 3-methyltransferase; 4732433J24; bA9819.1; C77934; Coenzyme Q (ubiquinone); coenzyme Q3 homolog methyltransferase; coenzyme Q3 homolog, methyltransferase; coenzyme Q3 homolog, methyltransferase (yeast); coenzyme Q3 methyltransferase; coenzyme Q3, methyltransferase; Coq3; DHHB methyltransferase; DHHBMT; DHHB-MT; DHHBMTASE; DHHB-MTase; dihydroxyhexaprenylbenzoate methyltransferase; hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; methyltransferase COQ3; polyprenyldihydroxybenzoate methyltransferase; Ubiquinone biosynthesis O-methyltransferase, mitochondrial; UG0215E05
• Common Name: COQ3
• Gene Symbol: COQ3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining