Invitrogen™ Human COQ2 (aa 296-334) Control Fragment Recombinant Protein

Product Code. 30195198

Brand: Invitrogen™ RP105048

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66026 (PA5-66026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate.

Specifications

• Accession Number: Q96H96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27235
• Name: Human COQ2 (aa 296-334) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4-HB polyprenyltransferase; 4-hydroxybenzoate decaprenyltransferase; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; CL640; coenzyme Q2 4-hydroxybenzoate polyprenyltransferase; coenzyme Q2 homolog, prenyltransferase; coenzyme Q2, polyprenyltransferase; COQ10D1; COQ2; MSA1; para-hydroxybenzoate-polyprenyltransferase, mitochondrial; PHB:polyprenyltransferase; PHB:PPT
• Common Name: COQ2
• Gene Symbol: COQ2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining