Invitrogen™ Human COPS6 (aa 249-322) Control Fragment Recombinant Protein

Product Code. 30205539

Brand: Invitrogen™ RP92864

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60673 (PA5-60673. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr.

Specifications

• Accession Number: Q7L5N1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10980
• Name: Human COPS6 (aa 249-322) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: COP9 (constitutive photomorphogenic) homolog, subunit 6; COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana); COP9 (constitutive photomorphogenic), subunit 6; COP9 complex S6; COP9 constitutive photomorphogenic homolog subunit 6; COP9 signalosome complex subunit 6; COP9 signalosome complex subunit 6-like protein; COP9 signalosome subunit 6; cops6; CSN6; H_NH0506M12.12; hVIP; hypothetical protein LOC550465; JAB1-containing signalosome subunit 6; MOV34 homolog; MOV34 homolog, 34 kD; MOV34-34 KD; Sgn3; SGN6; signalosome subunit 6; VIP/MOV34; Vpr-interacting protein; zgc:112075
• Common Name: COPS6
• Gene Symbol: COPS6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining