Invitrogen™ Human Contactin 2 (aa 898-1034) Control Fragment Recombinant Protein

Product Code. 30197824

Brand: Invitrogen™ RP94791

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51571 (PA5-51571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Contactin 2 (CNTN2, transiently-expressed axonal glycoprotein, AXT, TAX, TAX1, TAG-1, axonin 1) is a neuronal cell adhesion molecule (CAM) that influences the formation of axon connections in the developing nervous system. Contactin 2 is a member of the immunoglobulin superfamily (IgSF) and contains a glycosylphosphatidylinositol-anchor, six immunoglobulin (Ig)-like and four Fibronectin type III (FNIII)-like domains. Contactin 2 is expressed predominantly during neural development on the cell membrane of axons in nerve fiber tracts in order to guide commissural axons without promoting their growth. Contactin 2 binds with NgCAM in the plane of the same membrane (cis-binding). The Contactin 2 heterophilic (Contactin 2/NgCAM and Contactin 2/NrCAM) binding sites are localized to the first four Ig domains. The Contactin 2 homophilic (Contactin 2/Contactin 2) binding site is localized to the FNIII domain.

Specifications

• Accession Number: Q02246
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6900
• Name: Human Contactin 2 (aa 898-1034) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Axonal glycoprotein TAG-1; axonin; Axonin 1; Axonin1; axonin-1; axonin-1 cell adhesion molecule; AXT; Cntn2; contactin 2; contactin 2 (axonal); contactin 2 (transiently expressed); Contactin2; contactin-2; D130012K04Rik; DKFZp781D102; FAME5; MGC157722; TAG1; TAG-1; TAG-564; Tax; TA x 1; TAX-1; transient axonal glycoprotein 1; transiently-expressed axonal glycoprotein
• Common Name: Contactin 2
• Gene Symbol: CNTN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining