Invitrogen™ Human Connexin 29 (aa 220-279) Control Fragment Recombinant Protein

Product Code. 30209789

Brand: Invitrogen™ RP91116

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q8NFK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 349149
• Name: Human Connexin 29 (aa 220-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: connexin 29; connexin-29; Connexin-30.2; connexin-31.3; C x 29; C x 30.2; C x 31.3; Gap junction epsilon-1 protein; gap junction gamma-3 protein; gap junction membrane channel protein epsilon 1; gap junction protein gamma 3; gap junction protein, gamma 3; gap junction protein, gamma 3, 30.2 kDa; Gjc3; GJE1
• Common Name: Connexin 29
• Gene Symbol: GJC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining