Invitrogen™ Human COMTD1 (aa 165-246) Control Fragment Recombinant Protein

Product Code. 30181257

Brand: Invitrogen™ RP99867

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59899 (PA5-59899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COMTD1 (Catechol O Methyltransferase Domain Containing 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includeO methyltransferase activity. An important paralog of this gene isENSG00000284844.

Specifications

• Accession Number: Q86VU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 118881
• Name: Human COMTD1 (aa 165-246) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810030M08Rik; Catechol O-methyltransferase domain-containing protein 1; catechol-O-methyltransferase domain containing 1; catechol-O-methyltransferase domain-containing protein 1; Comtd1; MT773; O-methyltransferase-containing protein; UNQ766/PRO1558
• Common Name: COMTD1
• Gene Symbol: COMTD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining