Invitrogen™ Human Complement C6 (aa 390-488) Control Fragment Recombinant Protein

Product Code. 30210845

Brand: Invitrogen™ RP100446

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60527. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C6 is a component of complement cascade. It is part of the membrane attack complex which can insert into the cell membrane and cause cell to lyse. People with C6 deficiency are prone to bacterial infection. Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P13671
• Concentration: 1.70 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 729
• Name: Human Complement C6 (aa 390-488) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW111623; C6; complement component 6; complement component C6
• Common Name: Complement C6
• Gene Symbol: C6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining