Invitrogen™ Human Collagen III (aa 1169-1271) Control Fragment Recombinant Protein

Product Code. 30212025

Brand: Invitrogen™ RP89616

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110732 (PA5-110732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Collagen III is a fibrillar collagen that is found in extensible connective tissues such as skin, lung, and the vascular system, frequently in association with type I Collagen. Mutations in th gene are associated with Ehlers Danlos syndrome type IV, and with aortic and arterial aneurysms. Although alternate transcripts have been detected for this gene, they are the result of mutations; these mutations alter splicing, often leading to the exclusion of multiple exons.

Specifications

• Accession Number: P02461
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1281
• Name: Human Collagen III (aa 1169-1271) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alpha1 (III) collagen; alpha-1 collagen type III; alpha-1 type III collagen; alpha-1 type-3 collagen; AW550625; COL 3; COL3; COL3 alpha 1; COL3A1; Col3a-1; collagen; Collagen 3; collagen alpha 1 type III; collagen alpha-1(III) chain; collagen type III alpha 1 chain; collagen, fetal; collagen, type III, alpha 1; collagen, type III, alpha 1 (Ehlers-Danlos syndrome type IV, autosomal dominant); collagen, type III, alpha 1 chain, fibril forming; Collagen3; EDS4A; Ehlers-Danlos syndrome type IV, autosomal dominant; FLJ34534; MGC93704; minisatellite 10 W detected by probe MMS10; mKIAA4231; MMS10-W; Ms10w; PIIINP; pro alpha 1 type III collagen; procollagen, type III, alpha 1; unknown
• Common Name: Collagen III
• Gene Symbol: Col3a1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining