Invitrogen™ Human COL6A2 (aa 941-1016) Control Fragment Recombinant Protein

Product Code. 30208403

Brand: Invitrogen™ RP104696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65222 (PA5-65222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The product of this gene contains several domains similar to von Willebrand Factor type A domains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in this gene are associated with Bethlem myopathy and Ullrich scleroatonic muscular dystrophy. Three transcript variants have been identified for this gene.

Specifications

• Accession Number: P12110
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1292
• Name: Human COL6A2 (aa 941-1016) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BTHLM1; Col6a2; Col6a-2; Collagen alpha-2(VI) chain; collagen type VI alpha 2; collagen VI, alpha-2 polypeptide; collagen, type VI, alpha 2; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; procollagen, type VI, alpha 2; UCMD1
• Common Name: COL6A2
• Gene Symbol: COL6A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining