Invitrogen™ Human COL1A1 (aa 49-143) Control Fragment Recombinant Protein

Product Code. 30210544

Brand: Invitrogen™ RP89655

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is the pro-alpha1 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

Specifications

• Accession Number: P02452
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1277
• Name: Human COL1A1 (aa 49-143) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alpha-1 type 1 collagen; alpha-1 type I collagen; alpha1(I) procollagen; COL1A; Col1a1; Col1a-1; Cola1; Cola-1; COLIA1; Collagen 1; collagen alpha 1 chain type I; collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; Collagen I; collagen of skin, tendon and bone, alpha-1 chain; collagen type I alpha 1; collagen, type 1, alpha 1; collagen, type I, alpha 1; Collagen1A1; EDSC; Mov13; Mov-13; OI1; OI2; OI3; OI4; pro-alpha-1 collagen type 1; procollagen type I, alpha 1; procollagen, type 1, alpha 1; procollagen, type I, alpha 1; Type I Collagen; type I proalpha 1; type I procollagen alpha 1 chain; type I-alpha 1 collagen
• Common Name: COL1A1
• Gene Symbol: COL1A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining