Invitrogen™ Human COL19A1 (aa 24-123) Control Fragment Recombinant Protein

Product Code. 30204422

Brand: Invitrogen™ RP92408

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59975 (PA5-59975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Collagen Type XIX is an 1,142 amino acid protein encoded by the human gene COL19A1. Collagen Type XIX belongs to the fibril-associated collagens with interrupted helices (FACIT) family. Collagen Type XIX is thought to act as a cross-bridge between collagen fibrils and other extracellular matrix molecules. Collagen Type XIX is also believed to be involved in skeletal myogenesis in the developing esophagus. It may also play a role in organization of the pericellular matrix or the sphinteric smooth muscle. Collagen Type XIX is normally found as an oligomer, the subunits being disulfide-linked. Expression of Collagen Type XIX is mainly localized to vascular, neuronal, mesenchymal, and some epithelial basement membrane zones in umbilical cord.

Specifications

• Accession Number: Q14993
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1310
• Name: Human COL19A1 (aa 24-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a1 chain of type XIX collagen; col19a1; COL9A1L; collagen alpha 1 (Y) chain; collagen alpha-1(XIX) chain; Collagen alpha-1(Y) chain; collagen type XIX alpha 1 chain; collagen XIX, alpha-1 polypeptide; collagen, type XIX, alpha 1; D6S228E; procollagen, type XIX, alpha 1
• Common Name: COL19A1
• Gene Symbol: COL19A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLWQVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining