Invitrogen™ Human COL17A1 (aa 10-106) Control Fragment Recombinant Protein

Product Code. 30203741

Brand: Invitrogen™ RP100377

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60461 (PA5-60461. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COL17A1 is the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein, and a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. COL17A1 is a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Moreover, COL17A1 is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. Diseases associated with COL17A1 dysfunction include epithelial recurrent erosion dystrophy and epidermolysis bullosa.

Specifications

• Accession Number: Q9UMD9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1308
• Name: Human COL17A1 (aa 10-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 120 kDa linear IgA dermatosis antigen; 120 kDa linear IgA disease antigen; 120 kDa linear IgA disease antigen homolog; 180 kDa bullous pemphigoid antigen 2; 97 kDa LAD antigen; 97 kDa linear IgA bullous dermatosis antigen; 97 kDa linear IgA disease antigen; alpha 1 type XVII collagen; BA16H23.2; bA16H23.2 (collagen, type XVII, alpha 1 (BP180)); BP180; BPA-2; Bpag; BPAG2; Bullous pemphigoid antigen 2; bullous pemphigoid antigen 2 (180 kD); Col17a1; Collagen alpha-1(XVII) chain; collagen type XVII alpha 1; collagen XVII, alpha-1 polypeptide; collagen, type XVII, alpha 1; ERED; LABD97; LAD-1; Linear IgA bullous disease antigen of 97 kDa; Linear IgA disease antigen 1; procollagen, type XVII, alpha 1; type XVII collagen alpha-1
• Common Name: COL17A1
• Gene Symbol: COL17A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining