Invitrogen™ Human COG3 (aa 607-705) Control Fragment Recombinant Protein

Product Code. 30213155

Brand: Invitrogen™ RP108403

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84200 (PA5-84200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of the conserved oligomeric Golgi (COG) complex which is composed of eight different subunits and is required for normal Golgi morphology and localization. Defects in the COG complex result in multiple deficiencies in protein glycosylation. The protein encoded by this gene is involved in ER-Golgi transport.

Specifications

• Accession Number: Q96JB2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83548
• Name: Human COG3 (aa 607-705) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: COG complex subunit 3; COG3; component of oligomeric golgi complex 2; component of oligomeric golgi complex 3; Conserved oligomeric Golgi complex subunit 3; E430004N23; p94; SEC34; tethering factor SEC34; vesicle-docking protein SEC34 homolog
• Common Name: COG3
• Gene Symbol: COG3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining