missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COG2 (aa 600-689) Control Fragment Recombinant Protein

Product Code. 30194724
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194724

Brand: Invitrogen™ RP94222

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67442 (PA5-67442. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The structure and function of the Golgi apparatus is controlled by a number of multi-protein complexes that are involved in glycosylation reactions and vesicular transport. The conserved oligomeric Golgi (COG) complex consists of three subcomplexes, termed LDLC, SEC34 and GTT (Golgi transport complex), all of which contain proteins necessary for proper Golgi operation. COG2 (conserved oligomeric Golgi complex subunit 2), also known as LDLC, is a 730 amino acid component of the COG complex. Localized to the cytoplasmic side of the Golgi apparatus, COG2 is required for proper Golgi morphology and function, specifically playing a role in Golgi ribbon formation and vesicular transport. Abnormal COG2 function may cause cell death, suggesting that COG2 is an important factor in cell viability.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14746
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22796
Name Human COG2 (aa 600-689) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190002B08Rik; 2700012E02Rik; brefeldin A-sensitive, peripheral Golgi protein; C86089; COG 2; COG complex subunit 2; COG2; Component of oligomeric Golgi complex 2; conserved oligomeric Golgi complex protein 2; conserved oligomeric Golgi complex subunit 2; LDLC; low density lipoprotein receptor defect C complementing; low density lipoprotein receptor defect C-complementing protein; Transcript ch4822
Common Name COG2
Gene Symbol Cog2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.