Invitrogen™ Human COG2 (aa 600-689) Control Fragment Recombinant Protein

Product Code. 30194724

Brand: Invitrogen™ RP94222

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67442 (PA5-67442. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The structure and function of the Golgi apparatus is controlled by a number of multi-protein complexes that are involved in glycosylation reactions and vesicular transport. The conserved oligomeric Golgi (COG) complex consists of three subcomplexes, termed LDLC, SEC34 and GTT (Golgi transport complex), all of which contain proteins necessary for proper Golgi operation. COG2 (conserved oligomeric Golgi complex subunit 2), also known as LDLC, is a 730 amino acid component of the COG complex. Localized to the cytoplasmic side of the Golgi apparatus, COG2 is required for proper Golgi morphology and function, specifically playing a role in Golgi ribbon formation and vesicular transport. Abnormal COG2 function may cause cell death, suggesting that COG2 is an important factor in cell viability.

Specifications

• Accession Number: Q14746
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22796
• Name: Human COG2 (aa 600-689) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002B08Rik; 2700012E02Rik; brefeldin A-sensitive, peripheral Golgi protein; C86089; COG 2; COG complex subunit 2; COG2; Component of oligomeric Golgi complex 2; conserved oligomeric Golgi complex protein 2; conserved oligomeric Golgi complex subunit 2; LDLC; low density lipoprotein receptor defect C complementing; low density lipoprotein receptor defect C-complementing protein; Transcript ch4822
• Common Name: COG2
• Gene Symbol: Cog2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining