Invitrogen™ Human COBRA1 (aa 17-95) Control Fragment Recombinant Protein

Product Code. 30197468

Brand: Invitrogen™ RP93093

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54169 (PA5-54169. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NELFB is a subunit of negative elongation factor (NELF), which also includes NELFA (WHSC2), either NELFC or NELFD (TH1L), and NELFE (RDBP), a heterodimer of SPT4 (SUPT4H1), to cause transcriptional pausing of RNA polymerase II (Narita et al., 2003).

Specifications

• Accession Number: Q8WX92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25920
• Name: Human COBRA1 (aa 17-95) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A730008L03Rik; AB041607; AI663983; Cobra1; cofactor of BRCA1; DKFZp586B0519; KIAA1182; MNCb-5210; Negative elongation factor B; negative elongation factor complex member B; negative elongation factor complex member B, Cobra1; negative elongation factor protein B; NELFB; NELF-B; ortholog of human cofactor of BRCA1 (COBRA1); RGD1307832; RP13-122B23.3
• Common Name: COBRA1
• Gene Symbol: NELFB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining