Invitrogen™ Human CNTROB (aa 34-158) Control Fragment Recombinant Protein

Product Code. 30203685

Brand: Invitrogen™ RP93413

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54762 (PA5-54762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNTROB is a centrosomal protein that interacts with BRCA2 and is required for centriole duplication and cytokinesis (Zou et al., 2005 ).

Specifications

• Accession Number: Q8N137
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116840
• Name: Human CNTROB (aa 34-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830165K03Rik; centrobin; centrobin, centriole duplication and spindle assembly protein; centrobin, centrosomal BRCA2 interacting protein; centrosomal BRCA2-interacting protein; CNTROB; LIP8; LYST-interacting protein 8; LYST-interacting protein LIP8; PP1221; RGD1307488
• Common Name: CNTROB
• Gene Symbol: CNTROB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining