Invitrogen™ Human CNTNAP5 (aa 451-513) Control Fragment Recombinant Protein

Product Code. 30212398

Brand: Invitrogen™ RP107687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67043 (PA5-67043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in the correct development and proper functioning of the peripheral and central nervous system and be involved in cell adhesion and intercellular communication.

Specifications

• Accession Number: Q8WYK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 129684
• Name: Human CNTNAP5 (aa 451-513) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CASPR5; cell recognition molecule Caspr5; CNTNAP5; contactin associated protein like 5; contactin associated protein-like 5; contactin-associated protein-like 5
• Common Name: CNTNAP5
• Gene Symbol: CNTNAP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSVSINARRNRITLTLDDEAAPPAPDSTWVQIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining