Invitrogen™ Human CNOT4 (aa 331-476) Control Fragment Recombinant Protein

Product Code. 30196499

Brand: Invitrogen™ RP102476

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82214 (PA5-82214. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNOT4 is a 575 amino acid protein with E3 ubiquitin ligase activity, mainly involved in protein modification and protein ubiquitination. It contains a ring type zinc finger domain of the C4C4 type, an RNA recognition motif and a bipartite nuclear localization signal.Studies show that CNOT4 is a component of the CCR4-NOT (CAF1) core complex that functions as general transcription regulation complex and has both a positive as well as a negative effect on the transcription of multiple functionally unrelated genes, thus controls gene expression. CNOT4 interacts with CNOT1 via C-terminus and with E2 ubiquitin ligases via C4C4 RING domain. Reports suggest that CNOT4 gets phosphorylated in response to DNA damage on consensus sites recognized by ATM and ATR.

Specifications

• Accession Number: O95628
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4850
• Name: Human CNOT4 (aa 331-476) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CCR4-associated factor 4; CCR4-NOT transcription complex subunit 4; CCR4-NOT transcription complex subunit 4 L homeolog; CCR4-NOT transcription complex subunit 4 S homeolog; CCR4-NOT transcription complex subunit 4 S homeolog; CCR4-NOT transcription complex, subunit 4; CCR4-NOT transcription complex, subunit 4 isoform a; CLONE243; cnot4; cnot4.S; E3 ubiquitin-protein ligase CNOT4; hypothetical protein; negative regulator of transcription 4; Not4; NOT4 (negative regulator of transcription 4, yeast) homolog; Not4h; Not4hp; Potential transcriptional repressor NOT4Hp; RING-type E3 ubiquitin transferase CNOT4; transcriptional repressor NOT4Hp; XELAEV_18019807mg
• Common Name: CNOT4
• Gene Symbol: CNOT4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining