Invitrogen™ Human CNOT1 (aa 231-317) Control Fragment Recombinant Protein

Product Code. 30202080

Brand: Invitrogen™ RP110110

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144749 (PA5-144749. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Scaffolding component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Its scaffolding function implies its interaction with the catalytic complex module and diverse RNA-binding proteins mediating the complex recruitment to selected mRNA 3'UTRs. Involved in degradation of AU-rich element (ARE)-containing mRNAs probably via association with ZFP36. Mediates the recruitment of the CCR4-NOT complex to miRNA targets and to the RISC complex via association with TNRC6A, TNRC6B or TNRC6C. Acts as a transcriptional repressor. Represses the ligand-dependent transcriptional activation by nuclear receptors. Involved in the maintenance of embryonic stem (ES) cell identity. [UniProt]

Specifications

• Accession Number: A5YKK6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23019
• Name: Human CNOT1 (aa 231-317) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030411K04Rik; AA815922; AD-005; adrenal gland protein AD-005; CCR4-associated factor 1; CCR4-NOT transcription complex subunit 1; CCR4-NOT transcription complex, subunit 1; CDC39; Cnot1; D830048B13; Kiaa1007; Negative regulator of transcription subunit 1 homolog; NOT1; NOT1 (negative regulator of transcription 1, yeast) homolog; NOT1H; RGD1308009
• Common Name: CNOT1
• Gene Symbol: CNOT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRDILMDRILPDSGGVAKTMMESSLADFMQEVGYGFCASIEECRNIIVQFGVREVTAAQVARVLGMMARTHSGLTDGIPLQSISAPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining